PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_72737.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 217aa    MW: 24441.8 Da    PI: 9.4137
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_72737.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53e-54171461129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                   lppGfrFhPtdee+++ yL++kv +  +e+ ++i evd++k ePw+Lpkk+k +++ewyf++++d+ky+tg r+nratk gyWkatgkdke+++   
  MLOC_72737.1  17 LPPGFRFHPTDEEIITSYLAPKVLNPAFEA-TAIGEVDMNKNEPWELPKKAKMGQNEWYFYCQKDRKYPTGIRTNRATKVGYWKATGKDKEIFNPhc 112
                   79**************************99.88***************99999*****************************************987 PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                   ++ l+g+kktLvfykgrap+gekt+Wvmheyrle
  MLOC_72737.1 113 TSMLIGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 146
                   8888****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-599180IPR003441NAC domain
PROSITE profilePS5100556.77617180IPR003441NAC domain
PfamPF023651.6E-2818145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MAGHLQVQQQ QQQQLELPPG FRFHPTDEEI ITSYLAPKVL NPAFEATAIG EVDMNKNEPW  60
ELPKKAKMGQ NEWYFYCQKD RKYPTGIRTN RATKVGYWKA TGKDKEIFNP HCTSMLIGMK  120
KTLVFYKGRA PSGEKTNWVM HEYRLEISKQ STSGLPTSIA NAAAINMSSK EYVVCRIFQK  180
NTGSGPSSMV SYEDVGTGPS NNDQSNRGAT DGMLKYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-5041843169NAC domain-containing protein 19
4dul_A5e-5041843169NAC domain-containing protein 19
1ut7_B5e-5041843169NO APICAL MERISTEM PROTEIN
1ut7_A5e-5041843169NO APICAL MERISTEM PROTEIN
1ut4_B5e-5041843169NO APICAL MERISTEM PROTEIN
1ut4_A5e-5041843169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197640.0FR819764.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC019 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465518.16e-81PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ22e-79NC100_ARATH; NAC domain-containing protein 100
TrEMBLF6IAY31e-165F6IAY3_HORVD; NAC transcription factor
STRINGMLOC_72737.11e-165(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39610.12e-77NAC domain containing protein 6